Деградация полная: Полная деградация: украинская элита проиграла страну

Содержание

Полная деградация: украинская элита проиграла страну

экспертРодион Мирошник

экспертРодион Мирошник

Есть два момента, исходя из последних событий, которые происходят на Украине. Первое, на мой взгляд, это потеря субъектности, а второе — деградация. Тот цирк, которые сегодня был с отчетном премьер-министра — это деградация.

Когда у вас приходят премьер-министры, один назначается и пишет программу, говорит: «Я вам 40% роста ВВП дам». Сейчас дает где-то неизвестно что. Второй приходит вообще без программы. Зачитывает какую-то хрень и рассказывает: «Вы же знаете, коронавирус же наступил, поэтому я ничего не знал, я только сейчас все осознал». Он у вас уже заканчивается, а вы все еще программу по нему не сделали.

Причина одна. Если клоун, шут может быть президентом, почему самокатчик не может быть премьером? То есть у вас происходит полная деградация. Вы строите великую аграрную державу, продав свою собственную землю. Бедуинам хотя бы нужно было дать бусы, а вам нужно просто пообещать кредит. Просто пообещать кредит, а вы землю и банки сдадите, все что можно, вы все сдадите. А вам еще ничего не дали и сказали, чтобы вы встали в очередь и ждали. Поездка в Берлин тоже крайне показательна. Показательна в том, что с Украиной крайне сложно вести переговоры и есть ли в этом на самом деле смысл, потому что она двинуться сама никуда не может.

Собралась группа юристов. Ермак — юрист, Резников — юрист, Зеленский — юрист. Половина закончили МГИМО с международным правом. И вы фантазируете. Один порождает тему с организацией будапештского формата, другие предлагают сделать американцев щитом. Это те вещи, которые никоем не касаются урегулирования от слова совершенно. Когда вы говорите, что есть люди, которые хорошо относятся к жителям Донбасса, то у вас их там в элите нет.

У вас нет ни одной политической партии, которая отстаивает Донбасс и права людей. Все борются только за себя родимых. Во власти этих людей нет. Резников? Который говорит: «Мы сейчас у всех проверим паспорта, разберемся, а всех остальных посадим». Ермак? Который говорит: «Мы с вами разговаривать не будем, вы для нас вообще не субъект». Зеленский? Который говорит, что нам Донбасс не интересен, что нам минский процесс интересен только для того, что для России сохранились санкции. Поэтому вы потеряли свою субъектность. И сейчас в этой ситуации крайне важна позиция России. На месте Франции и Германии я бы детально проанализировал заявление вашего министра иностранных дел по пунктам, где он отказывается от 6 из 13 пунктов. Украина устами официальной персоны отказывается от выполнения Минских соглашений. Это факт. Это опубликовано. Это сделано в виде документа или заявления. Я хотел бы знать, как Франция, Германия и Российская Федерация отреагируют на эти вещи и ОБСЕ, которая является модератором и посредником ведения переговоров.
Они должны дать четкий внятный вывод, потому что напрямую с вами продолжать играть в пинг-понг нет смысла. Вы уже заигрались.

Источник

понятие, определение, виды, причины и этапы регресса

Человек на протяжении всего своего существования постоянно двигается, на лицо прогрессивное движение вперед.

От первобытного человека с палкой-копалкой мы перешли к современному этапу развития с нанотехнологиями и иными достижениями. К сожалению, существует явление и обратное, оно называется деградацией. Давайте разберемся что значит деградация, как она протекает, каковы причины и виды этого явления.

Понятие деградации

Прежде чем разбираться с явлением, уделим внимание самому слову и отметим, каково его происхождение. Что означает слово «деградация»? В переводе с латинского дословно оно означает «шаг назад». В систему русского языка вошло не сразу, во времена Петра I. И значение было несколько иным, чем в современном мире. Оно раскрывалось как понижение по службе, лишение чина, увольнение, и все что с этим связано.

Только в начале XX века значение слова стало приближаться к современному ладу. Что означает слово «деградировать» в современном мире? Это процесс перехода от сложного состояния к более простому, когда наблюдается постепенное упрощение, разрушение, упадок или утрата свойств, качеств человека, иного организма, общества, природы, системы, молекул. Деградация затрагивает все сферы жизни и может повлиять на любое явление, процесс.

Деградация в разных сферах жизни

Достаточно тяжело понять, что значит деградация, если нет реальных примеров и ассоциаций. Приведем несколько разновидностей явления, которые помогут понять его сущность.

  1. Деградация почвы — изменение состояния почвы, которое наблюдается в постепенном ухудшении свойств, обеднении, потере полезных микроэлементов. То есть почва становится непригодной для возделывания, она стоит в запустении, на ней толком ничего не растет. Она не реализует возложенные на нее функции.
  2. Экологическая деградация является наиболее актуальной в современном мире. Это связано с вымиранием многих видов животных, уничтожением популяций растений и других живых существ. Тяжелая экологическая ситуация с ухудшением качества воды так же связана с деградацией.
  3. Химическая подразумевает переход от сложного вещества к простому, в таком случае происходит разложение молекул на простые частички. В результате сложное химическое вещество превращается простое — яркий пример деградации.

Теперь вы поняли, что значит деградация на примерах из различных областей нашей жизни и природы. Отметим, что явление затрагивает все, включая культуру, духовные ценности, общество в целом. Подробнее об этом явлении можно узнать тут: https://businessman.ru/new-chto-takoe-degradaciya-osnovnye-prichiny-degradacii.html.

Деградация личности

Явление, которое стоит в центре внимания и изучается многими учеными совершенно разных наук и сфер. Сам по себе человек не содержит в себе потенциала к разрушению, но такие случаи все же наблюдаются. Что значит деградация личности? Это, прежде всего, появление двух важных признаков — депрессии и апатии. Человек начинает терять уравновешенность, обучаемость, стремление познавать окружающий мир, развиваться, постоянно находиться в динамике.

Что значит деградация человека? Это процесс потери свойственных человеку качеств и свойств, утрачиваются чувства, суждения, способности, заложенные еще при рождении. Ухудшается память, способность концентрировать внимание, отсутствует интерес к жизни и окружающему миру.

Причины деградации

Разобрав, что значит деградация, перейдем к причинам, которые способны вызвать данное явление.

  1. Одиночество. Ученые доказали, что одинокие люди, те, кто перенес смерть близкого человека, подвержены постепенной деградации. Это связано с тем, что человек подвергается депрессии, у него появляется апатия, отсутствие интереса к жизни, пассивность, происходит непонимание жизненных ориентиров. Одинокие люди так же часто подвергаются постепенной деградации, в большинстве случаев это пенсионеры: у них начинается своеобразная подготовка к смерти. Люди отрекаются от интересов, увлечений, перестают подстраиваться под динамично развивающийся мир. Такое явление в теории называется замедленный суицид.
  2. Ощущение чувства ненужности. Когда потенциал и способности человека не раскрываются в полной мере, происходит личностный развал. Если человек перестает видеть в себе личность, значит он и не будет развивать ее в себе, а это яркий пример деградации.
  3. Чувство неуверенности, особенно после нескольких неудач подряд. У кого-то порождает желание все исправить и добиться все же своей цели, а у кого-то напротив, возникает состояние апатии.
  4. Духовная бедность, жестокость, безволие являются прямыми предпосылками к формированию и развитию деградации личности.
  5. Пагубные привычки, такие как наркомания, токсикомания, алкоголизм являются серьезными проблемами, порождающими отупение человека.
    Для примера, чтобы понять что означает деградировать от пагубной привычки, разберем алкогольную деградацию.

Алкогольная деградация

Алкоголизм давно признан учеными серьезным заболеванием, от которого страдают тысячи человек. Он неразрывно связан с деградацией личности. Исследования показали, что женщины подвергаются такому воздействию куда чаще, чем мужчины. Состояние алкоголизма в серьезных стадиях порождает чувство отрешенности от внешнего мира. Перед человеком ставится единственная цель — нахождение очередной порции алкоголя. Человек перестает следить за своей внешностью, пропадает интерес к окружающему миру и всему тому, что в ней происходит. Жизнь течет по шаблону «выпить-опохмелиться-выпить». В итоге человек, внутри которого есть личность превращается в неухоженное, неряшливое создание, которое влачит бессмысленное существование. Это пример распада личности.

Духовная деградация

Это очень серьезная проблема, с которой все чаще и глубже сталкивается современное общество. Что значит духовная деградация? Это падение нравственности, при котором люди забывают базовые ценности, заложенные еще с момента образования общества. К ним относятся доброта, искренность, достоинство, сопереживание. На центральный план выходят деньги, они создают обманчивое ощущение счастья, защищенности, радости, ведь они могут реализовать любое потребности. На самом деле это не так, деньги ускоряют процесс деградации общества. Человек все чаще думает, что для получения денег и достойной жизни можно не трудиться, а это не так. Наряду с этим, снижается уровень культурных потребностей, все реже мы замечаем прекрасное, которое находится вокруг нас, перестаем радоваться тому, что есть рядом. Духовная деградация общества постепенно ведет к гниению и в конечном итоге, распаду социума.

Этапы деградации

Данное явление многогранно, в зависимости от пораженного объекта. оно может протекать совершенно по-разному. Мы рассмотрим наиболее универсальные этапы деградации личности.

  1. Разочарование, отрицание и отторжение социальных потребностей, интересов. Человек перестает обращать внимание на родственников, окружающих его людей. В центр ставятся интересы самого себя, а не других, личность перестает выполнять возложенные на нее обязанности.
  2. Если вовремя не реагировать на обстоятельства первого этапа, деградация начинает принимать затяжной характер. В таком случае на смену приходят агрессия, гнев, обиды на окружающих. Постоянно наблюдается раздражительность, истерики, плохое настроение.
  3. Следующим этапом наступает зависть и приступы жестокости. У человека формируется устойчивое представление о том, что он живет хуже всех, у него нет столько денег, возможностей и иных объектов, как у других.
  4. Злость — это следующий этап деградации человека. На данном этапе наблюдается окончательное духовное разложение. Оно сопровождается грубостью, нецензурными выражениями, постоянными конфликтами с окружающими.
  5. Заключительным этапом является наступление полной деградации. Состояние, которое сопровождается употреблением алкогольных напитков, возможно увлечение токсическими веществами, наркотиками и иными средствами. Человек остается один и опускается на социальное дно, выйти из которого очень трудно, но можно.

Как защитить себя от этого?

Прежде всего, необходимо воспитывать и постоянно развивать в себе личность. Человек даже зачастую не понимает что происходит. В тот момент, когда он перестает интересоваться чем-то новым, развивать свои интересы и продуктивно проводить время — он начинает деградировать.

Как правило, мы заняты добычей материальных благ и средств, поэтому на духовные просто не хватает времени. Не нужно забывать читать, слушать классическую музыку, ходить в театр, кино, музеи, на выставки.

Развитие и деградация

Это два масштабных понятия, которые сопровождают общество на протяжении всего его развития. Вы можете посмотреть видео для того, чтобы максимально четко и быстро понять сущность этих процессов.

Полная деградация. Кто уничтожает украинские черноземы. Капитал

Будет ли кто-то делать капитальный ремонт в чужой квартире? В условиях долгосрочной аренды — возможно, но для большинства ответ однозначен: нет.

Это простая аналогия для ситуации с запретом продажи пахотных земель. Владельцы паев не инвестируют средства в улучшение состояния почв, потому что не управляют землей. Арендаторы также не готовы к капиталовложениям, потому что не имеют права собственности.

Как изменилось состояние украинских черноземов за период независимости Украины?

Гонка за валом

Отечественные аграрные производители находятся в своеобразной гонке по увеличению показателей урожая и экспорту зерна. В сегменте подсолнечника им нет равных.

За последнее десятилетие валовой сбор зерновых культур вырос вдвое до 62 млн тонн. Эксперты уверены, что это не предел и прогнозируют урожай 100 млн тонн. Благодаря чему происходит рост урожайности сельскохозяйственных культур?

Развитие технологий, семенной селекции, внесение минеральных удобрений делают цифры 80-100 млн тонн зерновых реальностью. В сочетании с плодородными почвами АПК остается одной из самых привлекательных отраслей украинской экономики.

Так выглядит эрозия почвы

Плодородие под вопросом

По площади черноземов Украина занимает четвертое место в мире после России, США и Китая. Речь идет о 28 млн га или 46% общей площади страны.

Плодородные земли — ключ к продовольственной безопасности государства, однако Украина — лидер по распаханности сельскохозяйственных угодий.

Больше всего распаханы земли в Херсонской области — 90,3%, Черкасской, Кировоградской, Винницкой, Запорожской, Днепропетровской и Николаевской областях — 85-87%. В этих регионах нарушен баланс между количеством пастбищ и сенокосов и площадями, предназначенными для выращивания агрокультур.

«Последствия высокой степени распаханности — деградация почв и опустынивание. Мы теряем не только биологическое разнообразие, но и водные объекты, в частности — малые реки», — говорит министр экологии Остап Семерак. По его словам, нынешняя модель управления землей вызывает 25% выбросов парниковых газов.

По информации ГУ «Госгрунтохрана», выращивание культур интенсивного минерального питания, уменьшение внесения органических удобрений, распространение процессов эрозии приводит к отрицательному балансу гумуса в почвах. Кроме того, на юге и востоке Украины большинство производителей для севооборота используют подсолнечник и пшеницу, игнорируя другие аграрные культуры. Это приводит к истощению почвенного покрова.

Мораторий или инвестиции

Вредит почве и мораторий на продажу аграрных угодий. Часть фермеров пытается максимизировать прибыль без инвестиций в улучшение качества земель.

Причину этого объясняет генеральный директор агрохолдинга HarvEast Дмитрий Скорняков: «Мораторий негативно влияет на качество земель. Большинство арендаторов пытаются получить прибыль здесь и сейчас. Зачем им инвестировать в чужую собственность».

Директор центра Госплодородия Валерий Греков объясняет, что на состояние почв влияют и объемы внесения минеральных удобрений. «Хозяйства, имеющие стабильно высокие урожаи, вносят около 1 тыс кг минеральных удобрений на гектар. Это позволяет получать 80-100 ц/га пшеницы и 70-80 ц/га ячменя», — говорит эксперт.

Однако азотные удобрения существенно подкисляют почвенный покров, способствуя его деградации. Внесение органических удобрений за период независимости по сравнению с 1970-1980 годами резко сократилось, что тоже влияет на состояние почв.

Климатические вызовы

Не последнюю роль в ситуации с деградацией почв играют изменения климата. Ученые говорят о неизбежном опустынивание южных и восточных областей Украины.

За последние 30-40 лет пределы климатических зон сместились на 200-300 км в северном направлении. В полесской зоне в десятки раз увеличились площади посева подсолнечника и кукурузы. Урожайность кукурузы там достигает 110-150 ц/га несмотря на то, что уровень плодородия почв на Полесье значительно ниже, чем в степной и лесостепной зонах.

Кто ответит

В Министерстве экологии и природных ресурсов отмечают, что для успешного ведения аграрного бизнеса нужно реконструировать оросительные системы на площади 645,5 тыс га и построить новые на площади 171,5 тыс га.

«Качество земель ухудшается и из-за старых технологии, например, глубокой вспашки, приводящей к водной и ветровой эрозии», — говорит Скорняков. Его компания, которая работает в Донецкой области, из-за засушливых условий начала выращивать бобовые культуры.

Для сохранения плодородия земель аграрные производители должны применять почвозащитные технологии. Речь идет о минимизации обработки полей, возвращение в почву соломы и корневых остатков.

Фермеры также должны уменьшать нагрузку на единицу площади от колес почвообрабатывающей техники.

Вопрос об ответственном отношении к земле стоит не только перед фермерами, но и перед властью. В статье 14 Конституции говорится, что земля является основным национальным богатством, находящимся под особой охраной государства.

Однако вопрос регулирования структуры посевных площадей остается открытым. Из-за теневой обработки земли аграрные производители не соблюдают севооборот. Несмотря на запрет сжигания стерни и соломы, осенью часто можно увидеть на поле огонь, уничтожающий плодородный верхний слой почвы.

«В зависимости от уровня процессов деградации урожайность может уменьшиться на 50%, а потери аграрных производителей — превысить 20 млрд грн в год. Агросектор Украины виновен в появлении 35-40% всех деградированных земель в стране», — отмечает Семерак.

А так выглядит опустынивание

«Источники информации о состоянии почв в Украине ограничены. В основном используются данные земельного кадастра и материалы агрохимической паспортизации земель», — комментирует координатор программ развития ФАО в Украине — продовольственной и сельскохозяйственной организации ООН — Михаил Малков.

Читайте также: Ловкость рук на грани мошенничества: как украинцы дурят Uber, BlaBlaCar, Airbnb и Booking. com

По его словам, Украина нуждается в качественном мониторинге состояния почв, однако в стране отсутствует соответствующая государственная сеть. Свой вклад обещают сделать ФАО и Глобальный экологический фонд. Они начинают проект стоимостью 1,8 млн долл по исследованию земель Киевской, Харьковской, Николаевской и Херсонской областей.

Никаких специалистов не будет. Полная деградация

Что ждёт образование в России, какие специалисты будут в нашей стране?

Что происходит с системой образования в России? Глобалистами поставлена задача — уничтожить систему образования в нашей стране, с тем чтобы резко понизить интеллектуальный уровень нации. Это раз. И с тем чтобы убить основные научные школы. Прежде всего те, которые работают на военно-промышленный комплекс. Это два. Мы уже 30 лет живём за счёт советского наследия и тех научных школ, которые были там созданы. А сейчас тихой сапой происходит уничтожение и ликвидация этого наследия. И значительная его часть уже ликвидирована.

Можете возразить: но наши студенты и школьники побеждают на международных олимпиадах! Напомню, что во все времена есть вундеркинды, какие-то отдельные личности, которые обладают задатками гениальности и так далее. Но мерить по победам на олимпиадах саму систему образования — абсолютно неверно. А если говорить о самой системе образования, то она деградирует, деградирует семимильными шагами.

Клиповость мышления стала нормой для современного школьника и студента. Нет целостности мировосприятия, нет способности выражать свои мысли. Много говорунов, которые рассуждают обо всём понемногу. Ведь, прежде чем что-то высказать и на чём-то настаивать, надо обладать суммой знаний, приводить факты, приводить систему доказательств и так далее. А у нас просто болтают. Даже на телевизионных ток-шоу – треплются, и всё. При этом весь свой трёп не подкрепляют ни аргументами, ни фактами, ни документами. То есть отсутствует элементарная логика даже в ведении спора. Вот о чём речь идёт.

Я уж не говорю о том, что современного школьника вообще отучили письменно выражать свои мысли. Они просто элементарно не умеют писать. Более того, если садятся и начинают что-то писать — это такое количество грамматических и орфографических ошибок, что просто тихий ужас. Ведь основой русской и советской школы были прежде всего русский язык и литература.

Помните, в 90-е годы в переходах можно было спокойно купить диплом о высшем образовании? В своё время у нас существовали целые частные вузы, даже при государственных местных вузах были конторы по выдаче дипломов. Дипломы элементарно покупались. Сейчас эта ситуация несколько поменялась, но тем не менее вплоть до последнего дня во многих высших учебных заведениях, особенно частных, студенты зачастую просто числились в качестве таковых. На самом деле они не учились, но получали дипломы государственного образца. Потом государство схватилось за голову, начало наводить порядок в этой сфере. Но до конца вопрос так и не был решён.

Если же так будет продолжаться и дальше, то никаких специалистов не будет. Дальнейшая деградация.

Мнение автора может не совпадать с мнением редакции.

Деменция

Деменция — это синдром, обычно хронический или прогрессирующий, при котором происходит деградация когнитивной функции (то есть способности мыслить) в большей степени, чем это ожидается при нормальном старении. Происходит деградация памяти, мышления, понимания, речи и способности ориентироваться, считать, познавать и рассуждать. Деменция не оказывает воздействия на сознание. Нарушение когнитивной функции часто сопровождается, а иногда предваряется ухудшением контроля над эмоциональным состоянием, а также деградацией социального поведения или мотивации.

К развитию деменции приводят различные болезни и травмы, которые в первую или вторую очередь вызывают повреждение мозга, такие как болезнь Альцгеймера или инсульт.

Деменция является одной из основных причин инвалидности и зависимости среди пожилых людей во всем мире. Она может оказывать глубокое воздействие не только на страдающих ею людей, но и на их семьи и тех, кто осуществляет уход. Часто ощущается недостаточная осведомленность в отношении деменции и недостаточное понимание этого состояния, что приводит к стигматизации и возникновению препятствий для диагностирования и оказания медицинской помощи. Воздействие деменции на людей, осуществляющих уход, семью и общества в целом может быть физическим, психологическим, социальным и экономическим.

Признаки и симптомы

Деменция по-разному поражает людей — это зависит от воздействия болезни и от индивидуальных особенностей человека перед заболеванием. Признаки и симптомы, связанные с деменцией, проходят три стадии развития.

Ранняя стадия: ранняя стадия деменции часто остается незамеченной, так как развивается постепенно. Общие симптомы включают:

  • забывчивость;
  • потерю счета времени;
  • нарушение ориентации в знакомой местности.

Средняя стадия: по мере прогрессирования деменции к средней стадии признаки и симптомы становятся более явными и все более суживающими возможности. Они включают:

  • забывчивость в отношении недавних событий и имен людей;
  • нарушение ориентации дома;
  • возрастающие трудности в общении;
  • потребность в помощи для ухода за собой;
  • поведенческие трудности, включая бесцельное хождение и задавание одних и тех же вопросов.

Поздняя стадия: на поздней стадии деменции развивается почти полная зависимость и пассивность. Нарушения памяти становятся значительными, а физические признаки и симптомы более очевидными. Симптомы включают:

  • потерю ориентации во времени и пространстве;
  • трудности в узнавании родственников и друзей;
  • возрастающую потребность в помощи для ухода за собой;
  • трудности в передвижении;
  • поведенческие изменения, которые могут усугубляться и включать агрессивность.

Распространенные формы деменции

Существует много форм деменции. Болезнь Альцгеймера является наиболее распространенной формой — на нее приходится 60-70% всех случаев. Другие распространенные формы включают сосудистую деменцию, деменцию с тельцами Леви (аномальные включения белка, образующиеся внутри нервных клеток) и группу болезней, способствующих развитию лобно-височной деменции (дегенерации лобной доли мозга). Между разными формами деменции нет четких границ, и часто сосуществуют смешанные формы деменции.

Показатели деменции

Во всем мире насчитывается около 50 миллионов людей с деменцией, причем более половины, почти 60% из них живут в странах с низким и средним уровнем дохода. Ежегодно происходит около 10 миллионов новых случаев заболевания.

По оценкам, доля общего населения в возрасте 60 лет и старше с деменцией на какой-либо момент времени составляет от 5% до 8%.

По прогнозам, общее число людей с деменцией составит около 82 миллиона человек в 2030 году и 152 — к 2050 году. Такой рост будет происходить в значительной мере за счет роста числа людей с деменцией в странах с низким и средним уровнем дохода.

Лечение и уход

В настоящее время не существует какой-либо терапии для излечения деменции или изменения хода ее развития. Исследуются многочисленные новые лекарственные средства, которые находятся на разных стадиях клинических испытаний.

Тем не менее можно многое сделать для поддержки и улучшения жизни людей с деменцией, тех, кто осуществляет уход за ними, и их семей. Основными целями медицинской помощи в отношении деменции являются следующие:\n

  • раннее диагностирование для обеспечения раннего и оптимального ведения;
  • оптимизация физического здоровья, когнитивных способностей, активности и благополучия;
  • выявление и лечение сопутствующей физической болезни;
  • выявление и лечение поведенческих и психологических симптомов;
  • предоставление информации и долгосрочной поддержки для тех, кто осуществляет уход.

Факторы риска и профилактика

Несмотря на то, что возраст является важнейшим известным фактором риска развития деменции, она не является неизбежным последствием старения. Более того, деменция поражает не только пожилых людей — на раннее наступление деменции (определяемое как появление симптомов в возрасте до 65 лет) приходится до 9% всех случаев деменции.

Исследования показывают, что риск развития деменции можно снизить, если регулярно заниматься физическими упражнениями, не курить, избегать вредного употребления алкоголя, контролировать свой вес, правильно питаться и поддерживать нормальные уровни кровяного давления, холестерина и сахара в крови. Другие факторы риска включают депрессию, низкий уровень образования, социальную изоляцию и отсутствие когнитивной активности.

Социальное и экономическое воздействие

Деменция оказывает значительное социальное и экономическое воздействие с точки зрения медицинских расходов, расходов на социальную помощь и неофициальную помощь. В 2015 году общие глобальные общественные расходы на деменцию оценивались в 818 миллиардов долларов США, что соответствует 1,1% всемирного валового внутреннего продукта (ВВП). Общие расходы в качестве доли ВВП варьировались от 0,2% в странах с низким уровнем дохода до 1,4% в странах с высоким уровнем дохода.

Воздействие на семьи и тех, кто осуществляет уход

Деменция может оказывать глубокое воздействие на семьи страдающих ею людей и тех, кто осуществляет уход за ними. Физическая, эмоциональная и финансовая нагрузка может приводить к большому стрессу членов семей и людей, осуществляющих уход, и им необходима поддержка со стороны здравоохранительной, социальной, финансовой и правовой систем.

Права человека

Люди с деменцией часто бывают лишены основных прав и свобод, доступных для других людей. Во многих странах в домах престарелых и учреждениях интенсивной терапии широко используются физические средства и химические препараты для удержания пациентов, даже несмотря на наличие нормативных положений по защите прав человека на свободу и выбор.

Для обеспечения высококачественного ухода о людях с деменцией и тех, кто осуществляет уход за ними, необходимо надлежащее и поддерживающее нормативно-правовое обеспечение, основанное на признанных на международном уровне стандартах в области прав человека.

Деятельность ВОЗ

ВОЗ признает деменцию в качестве одного из приоритетов общественного здравоохранения. В мае 2017 г. Всемирная ассамблея здравоохранения одобрила «Глобальный план действий сектора здравоохранения по реагированию на деменцию на 2017-2025 гг. ». План представляет собой комплексную программу действий для лиц, формирующих политику, международных, региональных и национальных партнеров и ВОЗ в следующих областях:  

  • принятие мер в отношении деменции в качестве приоритета общественного здравоохранения; повышение осведомленности о деменции и создание инициатив по формированию благоприятных условий для людей с деменцией; снижение риска развития деменции; 
  • снижение риска развития деменции; диагностика, лечение и уход; 
  • информационные системы по деменции; поддержка лиц, осуществляющих уход за людьми с деменцией; и 
  • научные исследования и инновации. 

Для лиц, формирующих политику, и исследователей была создана Международная платформа для мониторинга — Глобальная обсерватория по деменции, — которая предназначается для содействия мониторингу и обмену информацией о политике в отношении деменции, медицинском обслуживании, эпидемиологии и научных исследованиях. ВОЗ также разрабатывает платформу для обмена знаниями в целях содействия обмену передовым опытом в области деменции.

ВОЗ разработала план действий по реагированию на деменцию для содействия государствам-членам в разработке и операционализации планов действий в отношении деменции. Это руководство тесно связано с Глобальной обсерваторией ВОЗ по проблеме деменции и включает соответствующие методики, такие как контрольный перечень, которым следует руководствоваться при подготовке, разработке и осуществлении планов действий в отношении деменции. Кроме того, это руководство может быть полезным при определении заинтересованных сторон и установлении приоритетов.

«Руководство ВОЗ по снижению риска развития когнитивных расстройств и деменции» содержит основанные на фактических данных рекомендации в отношении мер по снижению изменяемых факторов риска развития деменции, таких как отсутствие физической активности и нездоровое питание, а также по контролю медицинских состояний, связанных с деменцией, включая гипертензию и диабет.

Деменция также входит в число приоритетных состояний в рамках Программы действий по ликвидации пробелов в области психического здоровья (mhGAP), являющейся важным ресурсом для врачей общего профиля, особенно в странах с низким и среднем уровнем дохода, которым они могут пользоваться при оказании медицинской помощи первой линии в связи с психическими и неврологическими проблемами и расстройствами, вызванными употреблением психоактивных веществ.   

ВОЗ разработала программу «iSupport», с помощью которой лица, осуществляющие уход за людьми с деменцией, могут получать информацию и овладевать специальными навыками. Веб-программа «iSupport» доступна в виде печатного руководства и уже используется в ряде стран. В ближайшее время будет доступна онлайн версия «iSupport». 

«,»datePublished»:»2021-09-02T12:00:00.0000000+00:00″,»image»:»https://www.who.int/images/default-source/imported/en-dementia.jpg?sfvrsn=1a94c86c_2″,»publisher»:{«@type»:»Organization»,»name»:»World Health Organization: WHO»,»logo»:{«@type»:»ImageObject»,»url»:»https://www.who.int/Images/SchemaOrg/schemaOrgLogo.jpg»,»width»:250,»height»:60}},»dateModified»:»2021-09-02T12:00:00.0000000+00:00″,»mainEntityOfPage»:»https://www.who.int/ru/news-room/fact-sheets/detail/dementia»,»@context»:»http://schema.org»,»@type»:»Article»};

Волжский | «Полная деградация РФ»: юрист высказался об аресте защитника Волга-Ахтубинской поймы и велоактивиста Соломонова

В Волжском 9 февраля началось с активного обсуждения в сети новости о решении суда по делу Соломонова, активиста, организатора велопробегов и одного из главных защитников Волга-Ахтубинской поймы небезызвестного в нашем городе. Накануне до поздней ночи в Центральном райсуде Волгограда проходило слушание. 

В итоге, по данным  объединенной пресс-службы судов Волгоградской области, Михаила Соломонова признали виновным в организации велопробега, который создал помехи движению ТС. За это мужчине присудили 5 суток ареста. 

На этом обвинения не закончились. Михаила Соломонова признали виновным в неповиновении законному распоряжению полицейских о прекращении съемки на телефон. Напомним, Соломонов в отделении полиции настаивал на выдачи копии административного протокола, снимая происходящее на камеру телефону. За это урбанисту дали еще 10 суток ареста. 

— Судья выслушала в качестве показаний сотрудников полиции, приняла из за основу, — рассказывает свидетель и юрист Иван Иванов. — По результатам рассмотрения можно сделать вывод о личности судьи, о разложении нашей правовой системы и о полной деградации Российской Федерации. Сроки говорят сами за себя. Человек, который ничего не делал, ничего не нарушал, не призывал, ему впаяли 5 и 10 суток на ровном месте, на показаниях полиции.  

Защищал Соломонова Антон Гетманенко. Он после суда тоже высказал свое мнение о решении.

— Мы стали свидетелями расправы, — произнес защитник, выйдя из здания суда. — Мы даже не участники процесса, мы просто свидетели расправы над спортсменом, над велосипедистом, которому просто за велопрогулку дали 15 суток, 10 по одному и 5 по другому. Кроме как расправой, я это не могу назвать. 

Напомним,  арестовали Михаила  7 февраля за неповиновение сотрудникам полиции и организацию массового одновременного передвижения граждан в общественных местах, повлекшее нарушение порядка 31 декабря прошлого года.

В Волжском Михаила Соломонова знают и как защитника поймы, который  активно ведет борьбу за сохранение дубов , и как велоубраниста, который  борется за удобство и комфорт велосипедистов в том числе и в Волжском . 

Олег Евсеев

Последняя стадия отчаянной любви — полная и жестокая деградация собственного Я.

ПОХОЖИЕ ЦИТАТЫ

ПОХОЖИЕ ЦИТАТЫ

Осень – последняя, самая восхитительная улыбка года.

Уильям Каллен Брайант (1)

Люди как скрипки: когда рвется последняя струна, становишься деревом.

Кармен Сильва (10+)

Истинное величие начинается с понимания собственного ничтожества.

Иоганн Вольфганг Гете (100+)

У человека есть только два пути: или прогресс, или деградация; консерватизм в чистом виде противоречит сути законов вселенной.

Альфред Норт Уайтхед (5)

Любые отношения — это совместное развитие, или совместная деградация. Если один идет вперед, а другой стоит на месте — люди расходятся. Это закон.

Неизвестный автор (1000+)

Необходимо помнить ту границу, где кончается полная достоинства вежливость и где начинается низкопоклонство.

Кодекс чести русского офицера, 1904г. (30+)

Ничто не ранит так человека, как осколки собственного счастья…

Михаил Жванецкий (100+)

Переработка отходов и ограничение скорости движения — это полная чушь. Мне это напоминает тех курильщиков, что решают бросить курить, лежа на смертном одре.

Бойцовский клуб (50+)

Жизнь, полная ошибок, почетнее и ценнее жизни, потраченной на бездействие.

Джордж Бернард Шоу (100+)

Грамм собственного опыта стоит дороже тонны чужих наставлений.

Махатма Ганди (50+)

Полное разложение – обзор

32.9.3 Прогноз нагрузки с учетом БПК, ХПК и других факторов

Оценка химической потребности в кислороде по отношению к БПК дает информацию из первых рук о том, сколько времени может потребоваться раствору для полного разложения. Если значение БПК 5 жидкости составляет 15 мг O 2 /л, а ХПК составляет, скажем, 75 мг O 2 /л, то для полной очистки жидкости потребуется 75÷(15÷5) или 25 дней. деградация. Это верно для отдельных химических веществ, но в смеси не позволяет отследить общее время, необходимое для полного разложения.Возможно насильственное окисление химического вещества в лаборатории, которое в естественных условиях может быть слишком трудно разлагать.

В общем, БПК помогает определить скорость естественного разложения, в то время как ХПК предсказывает, сколько кислорода требуется, и в сочетании с БПК, сколько дней может потребоваться раствору для полного разложения. БПК 5 данных сточных вод всегда меньше, чем соответствующий ХПК.

Для оценки БПК 5 ликвор разбавляют и добавляют известный объем к воде, насыщенной кислородом, содержащей микроэлементы и инокуляты организма.Закрытые флаконы инкубируют точно при 20°C в течение пяти дней в инкубаторах и сравнивают остаточный растворенный кислород с таковым в дубликатах, измеренным до инкубации; разница показывает потребление кислорода исключительно за счет присутствующего биоразлагаемого органического вещества. Испытания следует проводить при различных разбавлениях испытуемого раствора, как для наблюдения за эффектом разбавления, так и для достижения уровня, при котором в ходе испытания потребляется около половины растворенного кислорода. Метод имеет ряд ограничений, т. (i) это трудоемкий метод, (ii) он не дает информации о количестве органических загрязнителей, присутствующих в воде, которые не разлагаются бактериями, и (iii) выбор правильных бактерий является обязательным для получения стабильных результатов.

Для оценки ХПК окислитель, такой как K 2 Cr 2 O 7 , подмешивают в испытуемый разбавленный раствор в кислых условиях и кипятят в течение двух часов для окисления части раствора; неиспользованный дихромат оценивается, чтобы узнать, сколько было израсходовано.Значение указывает на общее органическое вещество, как разлагаемое, так и не поддающееся биологическому разложению. Измерение ХПК является более воспроизводимым, но ограниченным, поскольку некоторые органические загрязнители устойчивы к бихроматному окислению.

Вредным фактором является соотношение ХПК и БПК 5 . Чем ниже это отношение, тем выше скорость деградации сточных вод. Более высокое значение указывает на то, что деградация происходит слишком медленно и может занять больше времени. Это, в свою очередь, создает проблему существования бактерий в сточных водах, которые могут не справиться с токсичностью спиртных напитков и могут погибнуть.Для достаточно биоразлагаемых сточных вод соотношение должно быть ближе к 1, что практически очень трудно достичь.

Твердые вещества, присутствующие в слитом растворе, находятся либо во взвешенном, либо в растворенном состоянии, либо в комбинации этих двух состояний. Растворенные твердые вещества должны быть отделены от жидкости; в противном случае диффузия атмосферного кислорода в сточных водах будет замедлена. Большое количество соли, добавляемой в красильные ванны, а точнее в ванны прямого, серного и реактивного действия, вызывает серьезную озабоченность в этом отношении. Другие растворимые вспомогательные вещества применяются в очень низкой концентрации и распределяют меньшую нагрузку.С другой стороны, взвешенные частицы забивают дыхательные пути или жабры водных организмов, убивая их. Их разделение необходимо для сохранения свежести водоема.

Растворенный органический углерод (РОУ) представляет собой количество органического углерода, присутствующего в растворенной фазе после центрифугирования или мембранной фильтрации. Общий органический углерод (TOC) представляет собой органические загрязнители, как взвешенные, так и растворенные, и выражается в виде содержания углерода в сточных водах. Чем выше содержание углерода, тем больше кислорода требуется для окисления до CO 2 , время полного превращения будет длительным, и наоборот.

DOC и TOC приобрели большее значение в последние годы, поскольку они представляют собой все органические вещества, присутствующие в одной или обеих фазах, независимо от относительной легкости окисления. Следует отметить, однако, что вышеуказанные критерии касаются в основном органического загрязнения сточных вод. Они ничего не говорят о цвете, температуре, рН, содержании электролитов или тяжелых металлов; любой из этих факторов может оказаться решающим при определении приемлемости пробы сточных вод. Биоэлиминация включает материал, удаленный путем адсорбции на биомассе, а также материал, который подвергается биохимическому разложению.

Произошла ошибка при настройке пользовательского файла cookie

Этот сайт использует файлы cookie для повышения производительности. Если ваш браузер не принимает файлы cookie, вы не можете просматривать этот сайт.


Настройка браузера на прием файлов cookie

Существует множество причин, по которым файл cookie не может быть установлен правильно. Ниже приведены наиболее распространенные причины:

  • В вашем браузере отключены файлы cookie.Вам необходимо сбросить настройки браузера, чтобы принять файлы cookie, или спросить вас, хотите ли вы принимать файлы cookie.
  • Ваш браузер спрашивает, хотите ли вы принимать файлы cookie, и вы отказались. Чтобы принять файлы cookie с этого сайта, нажмите кнопку «Назад» и примите файл cookie.
  • Ваш браузер не поддерживает файлы cookie. Попробуйте другой браузер, если вы подозреваете это.
  • Дата на вашем компьютере в прошлом. Если часы вашего компьютера показывают дату до 1 января 1970 г., браузер автоматически забудет файл cookie.Чтобы это исправить, установите правильное время и дату на своем компьютере.
  • Вы установили приложение, которое отслеживает или блокирует установку файлов cookie. Вы должны отключить приложение при входе в систему или проконсультироваться с системным администратором.

Почему этому сайту требуются файлы cookie?

Этот сайт использует файлы cookie для повышения производительности, запоминая, что вы вошли в систему, когда переходите со страницы на страницу. Предоставить доступ без файлов cookie потребует от сайта создания нового сеанса для каждой посещаемой вами страницы, что замедляет работу системы до неприемлемого уровня.


Что сохраняется в файле cookie?

Этот сайт не хранит ничего, кроме автоматически сгенерированного идентификатора сеанса в файле cookie; никакая другая информация не фиксируется.

Как правило, в файле cookie может храниться только информация, которую вы предоставляете, или выбор, который вы делаете при посещении веб-сайта. Например, сайт не может определить ваше имя электронной почты, если вы не решите ввести его. Разрешение веб-сайту создавать файлы cookie не дает этому или любому другому сайту доступ к остальной части вашего компьютера, и только сайт, создавший файл cookie, может его прочитать.

Полное разложение ксенобиотических поверхностно-активных веществ консорциумом аэробных микроорганизмов

Линейные алкилбензолсульфонаты в первую очередь подвергаются атаке посредством гидроксилирования алкильной цепи от метильной группы с последующим бета-окислением. Алкильная цепь метаболизируется чистыми культурами с образованием сульфофенилкарбоксилатов, которые накапливаются в среде. В смешанной культуре другие микроорганизмы способны разлагать сульфофенилкарбоксилаты. Образование моносульфатов этиленгликоля в качестве основных продуктов образования алкилэтоксисульфатов свидетельствует о расщеплении эфирных связей. Бактерии, участвующие в росте алкильной цепи, не могут использовать гидрофильную часть. Эта гидрофильная часть, в свою очередь, разрушается другими микроорганизмами. Разложение этоксилатов алкилфенолов и этоксилатов сильно разветвленных спиртов происходит за счет укорочения полиоксиэтиленовой цепи, оставляя гидрофобную часть молекулы. Биодеградация этоксилатов линейных спиртов и этоксилированных жирных аминов инициируется центральным расщеплением или омега-окислением.Последующее окисление алкильных цепей приводит к получению полиэтиленгликолей и вторичных этоксилированных аминов. Оба полярных фрагмента метаболизируются другими микроорганизмами. Разложение солей алкилтриметиламмония и алкиламинов инициируется разрывом связи Cалкил-N. Центральное деление приводит к образованию алканалей, которые легко превращаются путем бета-окисления. Бактерии, использующие алкильную цепь, не способны разлагать метиламины. Метиламины, в свою очередь, подвергаются биоразложению метилотрофами.Ограниченные метаболические возможности чистых культур микроорганизмов, использующих ПАВ, указывают на потребность консорциумов в полной деградации ПАВ. Полная деградация ПАВ осуществляется с помощью смешанных культур микроорганизмов, построенных на основе синергетических и комменсальных отношений. Однако разложение поверхностно-активного вещества одним из членов комменсалистического консорциума может привести к образованию токсичных или нетоксичных метаболитов. Очистка сточных вод без накопления таких метаболитов может быть достигнута на установках, эксплуатируемых со временем удержания ила, подходящим для поддержания всех микроорганизмов консорциума.Напротив, в природных экосистемах введение поверхностно-активного вещества может привести к кратковременному образованию метаболита.

Произошла ошибка при настройке пользовательского файла cookie

Этот сайт использует файлы cookie для повышения производительности. Если ваш браузер не принимает файлы cookie, вы не можете просматривать этот сайт.


Настройка браузера на прием файлов cookie

Существует множество причин, по которым файл cookie не может быть установлен правильно.Ниже приведены наиболее распространенные причины:

  • В вашем браузере отключены файлы cookie. Вам необходимо сбросить настройки браузера, чтобы принять файлы cookie, или спросить вас, хотите ли вы принимать файлы cookie.
  • Ваш браузер спрашивает, хотите ли вы принимать файлы cookie, и вы отказались. Чтобы принять файлы cookie с этого сайта, нажмите кнопку «Назад» и примите файл cookie.
  • Ваш браузер не поддерживает файлы cookie. Попробуйте другой браузер, если вы подозреваете это.
  • Дата на вашем компьютере в прошлом.Если часы вашего компьютера показывают дату до 1 января 1970 г., браузер автоматически забудет файл cookie. Чтобы это исправить, установите правильное время и дату на своем компьютере.
  • Вы установили приложение, которое отслеживает или блокирует установку файлов cookie. Вы должны отключить приложение при входе в систему или проконсультироваться с системным администратором.

Почему этому сайту требуются файлы cookie?

Этот сайт использует файлы cookie для повышения производительности, запоминая, что вы вошли в систему, когда переходите со страницы на страницу.Предоставить доступ без файлов cookie потребует от сайта создания нового сеанса для каждой посещаемой вами страницы, что замедляет работу системы до неприемлемого уровня.


Что сохраняется в файле cookie?

Этот сайт не хранит ничего, кроме автоматически сгенерированного идентификатора сеанса в файле cookie; никакая другая информация не фиксируется.

Как правило, в файле cookie может храниться только информация, которую вы предоставляете, или выбор, который вы делаете при посещении веб-сайта. Например, сайт не может определить ваше имя электронной почты, если вы не решите ввести его. Разрешение веб-сайту создавать файлы cookie не дает этому или любому другому сайту доступ к остальной части вашего компьютера, и только сайт, создавший файл cookie, может его прочитать.

A Полная деградация органофосфатов гидролизом в микроволновой печи

Название: Полная деградация органофосфатов гидролизом в микроволновой печи

Объем: 3 Выпуск: 3

Автор(ы): Петр Янса, Люси Чехова и Златко Янеба

Принадлежность:

Ключевые слова: Гидролиз, СВЧ, фосфорорганические соединения, параоксон, фосфорная кислота, детоксикация воды.

Abstract: Справочная информация: Органофосфаты составляют основу многих хорошо известных инсектицидов, гербицидов, лекарств и нервно-паралитических агентов. Поскольку они относятся к наиболее распространенным синтетических химикатов, был проведен поиск высокоэффективного метода их деградации. для.

Методы: Недавно был проведен эффективный гидролиз диэфиров фосфонатов с помощью микроволнового излучения до соответствующих фосфоновых соединений. кислот был разработан.Этот новый метод с использованием недорогого водного раствора соляной кислоты использовался для изучения гидролитическая деструкция фосфорорганических соединений.

Результаты: Изучен ход гидролиза под действием СВЧ-облучения на диэтилхлорфосфате, диизопропиловом хлорфосфат и параоксон в качестве модельных соединений. Впоследствии полный гидролиз до доброкачественной фосфорной кислоты был продемонстрирован на 20 токсичных фосфорорганических соединениях.

Вывод: Описанная методика представляет собой эффективную и безвредную для окружающей среды процедуру разложения. токсичных фосфорорганических соединений с широким спектром возможного применения, включая детоксикацию и очистку воды.

Выбросы парниковых газов в результате деградации тропических лесов: недооцененный источник | Углеродный баланс и управление

Сравнение выбросов от деградации лесов

Это исследование предлагает первый полный и последовательный анализ валовых выбросов от деятельности, связанной с деградацией лесных угодий в развивающихся странах в тропических и субтропических широтах. Мы оценили общие выбросы от деградации лесов в 2.1 Гт CO 2 e год −1 , из которых 53 % приходится на заготовку древесины, 30 % – на заготовку древесного топлива и 17 % – на лесные пожары.

Хотя Hosonuma et al. [14] не проводил количественную оценку выбросов, в этом исследовании была представлена ​​доля общего разложения в результате каждой активности разложения (самооценка стран) для подмножества стран, включенных в нашу область исследования. Хосонума и др. [14] оценили источники выбросов деградации как 51% от заготовки древесины, 31% от древесного топлива и 9% от пожаров (по сравнению с нашими результатами 53, 30, 17%). В разбивке по континентам Hosonuma et al. обнаружили, что заготовка древесины превышает 70% в Южной и Центральной Америке и Азии, но чуть более 30% в Африке; древесное топливо составляло 48% в Африке, но менее 20% в Азии и менее 10% в Южной и Центральной Америке; в то время как огонь составлял менее 20% в Южной и Центральной Америке, менее 10% в Африке и менее 5% в Азии. Таким образом, выводы Hosonuma et al. в значительной степени согласуются с выводами этого исследования (таблица 5) и подчеркивают, что заготовка древесины и древесного топлива вносят наибольший вклад в выбросы, связанные с деградацией лесов.

Таблица 5 Доля общих выбросов от деградации лесов в зависимости от деградационной деятельности по регионам

Для другого сравнения мы можем конкретно сравнить выбросы от заготовки древесины в бразильской Амазонии. Хуанг и Аснер [16] оценили годовые валовые выбросы в 0,15–0,18 Гт CO 2 в год −1 . Сравнивая только девять бразильских штатов, входящих в регион Амазонки, наше исследование оценивает выбросы в 0,28 Гт CO 2 в год −1 или более 1.в 5 раз выше, чем сообщают Хуанг и Аснер. Однако в исследовании Хуанга и Аснера прямо указано, что их оценка валовых годовых выбросов, вероятно, существенно занижает выбросы из-за исключения территорий, которые были обезлесены в последующие годы.

Выбросы в результате обезлесения по сравнению с деградацией лесов

Оценка валовых выбросов в результате обезлесения, представленная в данном исследовании (среднегодовой показатель за 2005–2010 гг. составляет 6,22 Гт CO 2 ), включена в первую очередь для того, чтобы служить основой для последовательного сравнения с оценками выбросы деградации.Недавние опубликованные оценки выбросов от обезлесения [1, 6, 13, 15, 26, 30] были меньше, чем наша оценка, в пределах от 2,3 до 4,2 Гт CO 2 год −1 . Есть несколько причин несоответствия между этими оценками, в том числе акцент на чистые, а не валовые выбросы, разные периоды времени, которые будут отражать более низкие исторические темпы обезлесения, например. с 2000–2005 гг. [13] по 2001–2013 гг. [30] – и разные направления исследований. Все оценки, как правило, включают только запасы углерода надземной биомассы в деревьях (за исключением [13], которая также включала подземную биомассу), однако наша оценка включает все пять пулов углерода МГЭИК, включая надземный, подземный, валежную древесину, подстилку, почву и торф. .Подземная биомасса лесов составляет около 20% или более надземной биомассы, а валежная древесина и подстилка составляют не менее 5% надземной биомассы. Выбросы из минеральной почвы при возделывании обычно составляют еще 20–25% надземных запасов. Принимая во внимание все эти факторы, выбросы в результате других исследований могут увеличиться в 1,5 раза или до диапазона 3,5–6,3 Гт CO 2  год −1 , при этом все еще не включая значительное количество торфяной почвы. выбросов в Индонезии и Малайзии.В свете всего этого мы делаем вывод, что наша оценка выбросов от обезлесения соответствует другим недавно опубликованным оценкам, упомянутым выше.

Выбросы в результате деградации лесов не являются незначительным источником CO 2 и составляют 25% суммарных выбросов в результате обезлесения и деградации лесов в размере 8,28 Гт CO 2  год −1 . Другими словами, выбросы от деградации эквивалентны примерно одной трети выбросов от обезлесения. По данным Углеродного фонда Всемирного банка, если выбросы в результате деградации лесов составляют более 10% всех выбросов, связанных с лесами, они должны быть включены и учтены.Как мы показали, выбросы от всех источников деградации лесов составляли менее 10% только в 11 из 74 стран, и, таким образом, всем остальным странам необходимо было бы включать деградацию лесов в свои системы учета. Однако в руководящих принципах даются указания только в отношении суммарной деградации лесов, а не в отношении отдельных видов деятельности. Например, в Колумбии суммарные выбросы от деградации равны 9% от общего объема выбросов, но все выбросы связаны с заготовкой древесины и, таким образом, могут быть исключены в соответствии с правилами FCPF. Напротив, суммарные выбросы от деградации в Перу составили 11%, а выбросы от лесозаготовок составили 8% от общего разложения. Хотя выбросы в Перу в результате деградации древесины менее значительны, чем в Колумбии, поскольку общие выбросы от деградации составляют более 10%, Перу необходимо будет также учитывать пожары и древесное топливо, хотя в сумме они составляют всего 3% выбросов. Таким образом, необходима политика, которая лучше формулирует включение и исключение видов деятельности, а не общий уровень деградации лесов.

Значение выбросов от деградации

Последовательные оценки выбросов, полученные в этом исследовании, позволяют нам рассмотреть значение общих выбросов в результате деградации лесов. Чтобы лучше проиллюстрировать это значение, мы напрямую сравнили наши оценки с выбросами по странам и секторам выбросов, указанным в базе данных WRI CAIT (http://cait.wri.org) за 2010 г. Согласно этому сравнению, выбросы деградации лишь значительно превышаются по энергетике и сельскому хозяйству (рис. 6). По странам общие выбросы в результате деградации лесов превышают все страны, кроме семи стран с наибольшим уровнем выбросов (рис. 6).

Рис. 6

Расчетные общие выбросы парниковых газов в результате деградации лесов по отношению к другим секторам выбросов (, верхний рисунок ) и по отношению к странам с крупными выбросами (, нижний рисунок ). Значения получены из WRI CAIT (http://cait.wri.org)

Неопределенности и опущенные источники

Цель этого анализа состояла в том, чтобы продемонстрировать масштабы выбросов в результате деградации лесов таким образом, который, насколько нам известно, является последовательным и точным.Для этого требуется точная информация о степени деградации лесов и связанных с ними выбросов. Что касается выборочных рубок, то были опасения по поводу данных, используемых для оценки выбросов, поскольку они могли включать объемы древесины, полученной с плантаций. Однако были предприняты шаги, чтобы гарантировать, что наши оценки IRP охватывают скорость извлечения только из естественных лесов. Коэффициенты выбросов от лесозаготовок были разработаны с использованием данных только из ограниченного числа стран, но имеют очень малые пределы погрешности, а рассматриваемые источники выбросов имеют значительную связь с характеристиками леса [24].Анализ пожаров является пространственно-специфическим и глобальным, и был разработан, чтобы избежать двойного учета выбросов от пожаров и выбросов от пожаров, возникающих в результате или связанных с обезлесением. Наиболее неопределенным источником выбросов является древесное топливо, учитывая, что данные получены за один год.

Оценки выбросов от заготовки древесины, вероятно, будут занижены из-за исключения незаконных рубок, если предположить, что незаконные рубки не включены в национальную официальную статистику IRP.Важно признать, что исследования показывают, что 72% лесозаготовок являются незаконными в бразильской Амазонии, 61% в Индонезии и 65% в Гане [21].

Другим упущением является деградация из-за чрезмерного выпаса скота. Этот источник был включен в Hosonuma et al. [14], которые сообщили, что эта деятельность ответственна за 7% пантропической площади деградации лесов (наименее важная форма деградации в исследовании). Кроме того, воздействие выпаса скота преимущественно на возобновление с повреждением сеянцев и саженцев.Таким образом, в краткосрочной перспективе воздействие на запасы углерода в лесах незначительно, хотя в последующие годы оно может возрасти по мере удаления будущих поколений молодых деревьев.

Условный контроль деградации флуоресцентного белка с помощью ауксин-зависимого нанотела

Клеточная культура

Родительские клетки и клетки HeLa FRT/TO были любезно предоставлены Jonathon Pines (ICR, London, UK) и клетками HeLa, экспрессирующими INCENP-GFP (INCENP -LAP) от BAC были любезным подарком Энтони Хаймана (MPI-CBG, Дрезден, Германия).Клетки культивировали в соответствии со стандартными протоколами культивирования тканей млекопитающих, включая тестирование на микоплазму. Клетки HeLa поддерживали в среде Advanced DMEM (Gibco) с добавлением 2% FBS, 1% (об./об.) пенициллин-стрептомицина, 1% (об./об.) глутамакса и 0,5 мкг/мл амфотерицина В. Стабильные интегранты отбирали с 400 мкг /мл неомицина (конструкции, содержащие AID) и 0,5 мкг/мл пуромицина (конструкции TIR1 и свободного GFP) или 200 мкг/мл гигромицина (трансгены Venus, Venus-LMNA и CCND1-Venus).

ДНК-конструкции

Для экспрессии у млекопитающих мы использовали TIR1 риса с оптимизированным кодоном 6 .Для создания конструкции, экспрессирующей TIR1, кассета N-концевой сигнал ядерной локализации (NLS)-TIR1–C-концевая HA-метка и N-концевая Myc-метка–сигнал ядерного экспорта (NES HIV rev)–TIR1, разделенная сайтом P2A, имеет был вставлен в вектор нацеливания Rosa26-CAG-IRES-puro выше IRES. Для создания слитых конструкций AID-Venus мы использовали кодон-оптимизированный A. thaliana IAA17 degron (AID) для экспрессии млекопитающих 6 и N-концевую тройную HA-tag-Venus-AID (полноразмерную) кассету или N-концевую тройную HA -tag-Венера-тройной минимизированный AID (3x mAID) или N-концевой тройной HA-tag-Венера-одиночный минимизированный AID (mAID) был вставлен в вектор pcDNA5/FRT/TO (Thermo Fisher Scientific) для индуцируемой тетрациклином гиперэкспрессии. Конструкции сверхэкспрессии, индуцируемые тетрациклином, содержащие нанотела vhhGFP4, были созданы путем вставки либо N-концевой тройной HA-метки–mAID–vhhGFP4, либо N-концевой тройной HA-метки–mAID K→R -vhhGFP4, либо N-концевой тройной HA-tag–mAID K→R -vhhGFP4 K→R в вектор pcDNA5/FRT/TO (Thermo Fisher Scientific).

Последовательности: Maid 69-132aa из A. thaliana IAA17 (ACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYK), Maid K → R (ACPRDPARPPARAQVVGWPPVRSYRRNVMVSCQRSSGGPEAAAFVRVSMDGAPYLRRIDLRMYR), vhhGFP4 K → R (MDQVQLVESGGALVQPGGSLRLSCAASGFPVNRYSMRWYRQAPGREREWVAGMSSAGDRSSYEDSVRGRFTISRDDARNTVYLQMNSLRPEDTAVYYCNVNVGFEYWGQGTQVTVSS).

Для визуализации экспрессии mAID-vhhGFP в экспериментах по транзиторной трансфекции последовательность mAID-vhhGFP была клонирована ниже IRES-элемента CMV-управляемого mCherry, слитого на его N-конце с N-концевым доменом связывания импортина β (IBB), создавая IBB-mCherry -IRES-MAID-vhhGFP в магистрали pIRESpuro (Thermo Fisher Scientific). LMNA амплифицировали из плазмиды, кодирующей GFP-Lamin A 33 , и клонировали на С-конце 3xHA-Venus. Флаг-мышиный CCND1 амплифицировали из слияния CCND1-CDK2 34 и клонировали на N-конце гистидиновой метки 3xHA-Venus-6x.Обратите внимание, что остатки T286 и T288 были заменены на аланин путем побочного мутагенеза. Все репортерные конструкции, включая Venus (3xHA-Venus-6x гистидиновая метка) и Venus-mAID (3xHA-Venus-mAID), были клонированы в основу pIREShygro3 (Thermo Fisher Scientific). Последовательности, кодирующие deGradFP и deGradFP ΔFbox , были подарены Маркусом Аффольтером (плазмиды Addgene #35579 и #35580) 8 и субклонированы для индуцируемой тетрациклином экспрессии в pCDNA5 FRT/TO (Thermo Fisher Scientific) с использованием сайтов рестрикции EcoRI и XbaI.

Для нацеливания гена ANAPC4 на N-конце с 3xFlag-SBP-Venus длинное плечо гомологии ~1500 пар оснований амплифицировали из геномной ДНК RPE-1 (hTERT) с использованием: ‘вместе с

XhoI-5′-ccgctcgagCAACATGGGGACGGCCctgcaacgacaccccagtcagaggccggc-3′ для левого и

HindIII 5′-cccaagcttCGTTTTCCGACCTGTTTCCCATCCTTCCGGGTG-3 ‘вместе с

NotI 5′-ataagaatGCGGCCGCaggtcatctctacaacactcaactcc-3′ олигонуклеотидов для правой руки гомологии соответственно. Фрагмент XhoI-3xFlag-SBP-Venus-15-аланин-глицин-линкер-HindIII амплифицировали из синтетической ДНК и клонировали вместе с обоими гомологическими плечами в сайты NotI pAAV-MCS (Stratagene). Для нацеливания mAID-Venus-ANAPC4 последовательность, кодирующая 3xFlag-SBP, была заменена на mAID с использованием сайтов EcoRI и XhoI, присутствующих в нуклеотидной последовательности 3xFlag-SBP-Venus.

Для создания конструкций рыбок данио использовали клонирование Gateway (Thermo Fisher Scientific) на основе набора Tol2 35 .Tol2-бактин: GFP-PCNA, клон среднего входа eGFP-PCNA 36 объединяли с клоном 5′ входа 35 промотора бета-актина и остовом pTol2 + pA R4-R2 37 . Tol2-bactin: GFP-LAP2b, клон LAP2b 3′ входа был создан путем амплификации Lap2b из pmRFP_LAP2beta_IRES_puro2b (подарок от Daniel Gerlich, плазмида Addgene # 21047) 38 с использованием прямого 5′-ggggacagctttctctgtacaaagtggctCTGTACAAGTACTCAGATCTC ggggacaactttgtataataaagttgcTCAGTTGGATATTTTAGTATCTTGAAGAAAATTAGTG-3′) с последующей рекомбинацией с 5′-входным клоном промотора бета-актина, средним входящим клоном GFP и остовом pTol2 + pA R4-R3 35 . HA-mAID K→R -vhhGFP4 K→R , Flag-myc-NES-TIR1, NLS-TIR-HA и mKate2 субклонировали в вектор pCS2+ для продукции РНК. h3B-RFP в pCS2+ был опубликован ранее 39 .

Получение клеточных линий

Для доставки ДНК-конструкций для получения всех клеточных линий использовали систему трансфекции Neon (Thermo Fisher Scientific). Стабильные клеточные линии HeLa FRT/TO и RPE-1 (hTERT) FRT/TO, экспрессирующие TIR1, Venus, Venus-LMNA, CCND1-Venus, были созданы путем случайной интеграции и отбора с пуромицином (0.5 мкг/мл) или бластицидин (5 мкг/мл). Стабильные клоны, экспрессирующие тетрациклин-индуцируемые конструкции Venus-AID, mAID-vhhGFP4, deGradFP и deGradFP ΔFbox , клонировали в векторы pCDNA5/FRT/TO (см. выше) и интегрировали в сайт FRT с использованием системы Flp-In (Thermo Fisher Scientific). ) в соответствии с инструкциями производителя с последующей селекцией неомицином (400 мкг/мл) и выделением отдельных клонов. Конструкции mAID-vhhGFP4 встраивали в сайт FRT одного и того же единственного родительского клона RPE-1 (hTERT) или HeLa, уже экспрессирующего TIR1, для обеспечения изогенного фона. Экспрессию mAID-нанотел в клетках Venus-LMNA индуцировали в течение 24 ч 10–20 нг/мл тетрациклина и 1 мкг/мл тетрациклина для клеток CCND1-Venus или Venus, если не указано иное. Для деградации Venus-ANAPC4 остаточного тетрациклина в среде было достаточно для деградации. Экспрессию deGradFP и deGradFP ΔFbox индуцировали 1 мкг/мл тетрациклина в течение указанного времени. Сайт-специфической интеграции 3× Flag-SBP-Venus в локусов ANAPC4 способствовала CRISPR/Cas9-опосредованная гомологичная рекомбинация с использованием гРНК, нацеленной на N-конец гена ANAPC4 (5′-ctgactggggtgtcgttgca-3′) .Вкратце, NLS-Flag-linker-Cas9 6 и нацеливающие конструкции pAAV-3xFlag-SBP-Venus или pAAV-mAID-Venus (см. выше) совместно гальванизировали в клетки HeLa FRT/TO с последующим восстановлением и размножением в течение одной недели. клеток. Впоследствии единичные Venus-положительные интегранты были идентифицированы и отсортированы с помощью проточной цитометрии. ПЦР и анализы секвенирования подтвердили, что в случае 3xFlag-SBP-Venus-ANAPC4, нацеленного на все аллелей ANAPC4 , тогда как в случае mAID-Venus-ANAPC4 был нацелен только один из трех аллелей ANAPC4 . Второй аллель демонстрировал усечение, удаляющее полный первый экзон, включая все потенциальные стартовые кодоны, в то время как третий аллель характеризовался делецией 10 пар оснований выше стартового кодона ANAPC4 , который включал акцепторный сайт сплайсинга соседней экзон-интронной границы. Анализ уровней ANAPC4 в общих лизатах и ​​включения ANAPC4 в APC/C (дополнительная фигура 4) с помощью вестерн-блоттинга показал, что меченый аллель кодирует единственный экспрессируемый белок ANAPC4.

Разведение рыбок данио

TL (RRID:ZIRC_ZL86) рыбок данио использовали для ауткроссинга трансгенных линий. Взрослых рыб содержали и выращивали при температуре 26 °C. Эмбрионы выращивали при 28,5 °C. Эмбрионы инкубировали в среде E3 с добавлением 0,2 мМ 1-фенил-2-тиомочевины (Sigma-Aldrich P7629) примерно через 5 часов после оплодотворения для предотвращения пигментации. Все работы с животными проводились в соответствии с директивой ЕС 2010/63/ЕС, а также с Законом Германии о защите животных, а эксперименты на животных были одобрены ответственными органами (Landesdirektion Dresden, Германия) в соответствии со всеми соответствующими этическими нормами.

Трансгенные линии рыбок данио

Линия GFP-PCNA Tg(бактин:GFP-PCNA) , повсеместно экспрессирующая меченный GFP ядерный антиген пролиферирующих клеток человека (PCNA), и линия GFP-LAP2b Tg(бактин:GFP -LAP2b) , повсеместно экспрессирующий GFP-меченый полипептид 2, ассоциированный с ламиной крысы, получали путем инъекции 1 нл плазмиды Tol2 в концентрации 30 нг/мкл вместе с РНК Tol2 в концентрации 50 нг/мкл в цитоплазму одноклеточных эмбрионы стадии. Эмбрионы F 0 с флуоресцентным сигналом выращивали до зрелого возраста, а носители Tg идентифицировали путем ауткроссинга с рыбами дикого типа.GFP-Utrophin Tg(actb2:GFP-Hsa.UTRN) 40 , mls-GFP Tg(XIa.Eef1a1:mlsEGFP) 41 и линия миозина II Tg(actb2:myl12.1- GFP) 42 были опубликованы ранее.

Вестерн-блоттинг и очистка APC/C

Клетки HeLa, обработанные IAA в течение указанного времени, дважды промывали PBS и непосредственно лизировали в буфере для образцов LDS (Thermo Fisher Scientific). APC/C очищали от асинхронно растущих клеток с использованием моноклональных антител ANAPC3 и ANAPC4, связанных с Dynabeads (Thermo Fisher Scientific) в соответствии с инструкциями производителя.Вкратце, клетки собирали путем трипсинизации, промывали в PBS, ресуспендировали в буфере для экстракции (30 мМ HEPES при pH 7,8, 175 мМ NaCl, 2,5 мМ MgCl 2 , 5% глицерина, 1 мМ дитиотреитола, 1 мМ фенилметилсульфонилфторида, ЭДТА). коктейль без ингибиторов протеазы (Sigma-Aldrich, COEDTAF-RO), 0,25% NP-40). После экстракции в течение 20 минут на льду экстракты очищали центрифугированием в течение 15 минут при 16 000× г , а супернатанты использовали для экспериментов по вытягиванию и иммунопреципитации.Анализ SBP проводили с помощью MyOne Streptavidin T1 Dynabeads (Thermo Fisher Scientific), а гранулы промывали 5 раз буфером для экстракции перед элюированием буфером для образцов LDS (Thermo Fisher Scientific). Белки разделяли с помощью SDS-PAGE с использованием 4–12% гелей Bis-Tris в буфере MES или MOPS. Вестерн-блоттинг выполняли в буфере 20% метанол/MOPS (все Thermo Fisher Scientific) в ячейке для электрофореза Mini Trans-Blot (Bio-Rad) и выявляли с помощью следующих антител в указанных разведениях: ANAPC4 (специальное мышиное моноклональное антитело, 1 :1000, подарок от Jonathon Pines, ICR London, UK), ANAPC4 (кроличьи поликлональные антитела, 1:2500, Bethyl Laboratories, A301–176A), ANAPC3 (специальные мышиные моноклональные антитела, 1:1000, подарок от Jakob Nilsson, The Novo Nordisk Foundation Center for Protein Research, Копенгаген, Дания), GFP (специальное козье поликлональное антитело, 1:5000, белковый центр Института молекулярной клеточной биологии и генетики им. Макса Планка, Дрезден, Германия), ANAPC10 (специальное кроличье поликлональное антитело, 1 :2500, подарок Джонатона Пайнса, ICR Лондон, Великобритания), ANAPC11 (специальное мышиное моноклональное антитело, 1:1000, подарок Джонатона Пайнса, ICR Лондон, Великобритания), Cyclin A (поликлональное антитело кролика, 1:500, Санта-Крус, sc-596, RRID:AB_631330), Cyclin B1 (мышиное моноклональное антитело, 1:1 000, BD Pharmingen, GNS-1, RRID:AB_395288), GAPDH (моноклональное антитело кролика, 1:5000, Cell Signaling, 2118), VHH против Camelid (моноклональное антитело кролика, 1:500, GenScript, A01860), ANAPC1 ( кроличьи поликлональные антитела, 1:2000, Bethyl Laboratories, A301–653A, RRID:AB_1210875), ANAPC2 (кроличьи моноклональные антитела, 1:1000, Cell Signaling, 12301), ANAPC5 (кроличьи поликлональные антитела, 1:1000, Bethyl Laboratories, A301 –026A, RRID:AB_2227119), ANAPC6 (козье поликлональное антитело, 1:500, Санта-Крус, sc-6395, RRID:AB_2074644), ANAPC7 (кроличье поликлональное антитело, 1:1000, Beethyl Laboratories, A302–550A, RRID:AB_1998915 ), ANAPC8 (кроличьи поликлональные антитела, 1:1000, Beethyl Laboratories, A301–181A, RRID:AB_890562), CDC20 (мышиные моноклональные антитела, 1:1000, Santa Cruz, sc-13162, RRID:AB_628089), FZR1 (мышиные моноклональные антитело, 1:500, Lab Vision, MS-1116-P, RRID:AB_64192), TUBA1 (моноклональное антитело мыши, 1:5000, Sigma-Aldrich, T5168). Белки mAID-vhhGFP и TIR1 были помечены эпитопом HA (см. конструкции ДНК) и обнаружены с помощью специального мышиного моноклонального антитела против HA (1:1000). Все эксперименты по вестерн-блоттингу анализировали на системе количественного сканирования в ближней инфракрасной области (ИК) (Odyssey, LI-COR) с использованием вторичных антител, связанных с ИК-красителями 680RD и 800CW (LI-COR). Необрезанные блоты всех данных вестерн-блоттинга, представленных на основных рисунках, показаны на дополнительном рисунке 8.

Инъекция РНК рыбкам данио

РНК была синтезирована с использованием набора SP6 mMessage Machine (Thermo Fisher Scientific, AM1340).РНК разводили в дважды перегнанном H 2 O с добавлением 0,05% фенолового красного (Sigma-Aldrich, P0290) и вводили в одну-две клетки эмбрионов на стадии 16–64 клеток для достижения мозаичной экспрессии. Инъекционная смесь, обеспечивающая наиболее эффективное разложение, содержала 60 нг/мкл РНК Flag-myc-NES-TIR1, 60 нг/мкл NLS-TIR1-HA, 4 нг/мкл HA-mAID K→R -vhhGFP4 K→R РНК и 30 нг/мкл h3B-RFP или mKate2 РНК для маркировки инъецированных клеток. Вводимый объем составлял 1–2 нл.

Обработка IAA и NAA

IAA (натриевая соль индол-3-уксусной кислоты, Sigma-Aldrich I5148) разбавляли в ddH 2 O до получения 0.5 M исходный раствор хранят при температуре –20 °C и используют в течение 1 месяца. NAA (натриевая соль 1-нафталинуксусной кислоты, ChemCruz, sc-296386) разбавляли и использовали так же, как IAA, и хранили при комнатной температуре до месяца. И IAA, и NAA применяли в культуре клеток HeLa и RPE-1 (hTERT) и в экспериментах с рыбками данио в конечной концентрации 0,5 мМ.

Если не указано иное, обработку эмбрионов рыбок данио ауксином начинали через 4–5 часов после оплодотворения, когда эмбрионы переносили в чашку Петри диаметром 90 мм, содержащую среду E3 без метиленового синего с добавлением 0.5 мМ ауксина, 5 мМ HEPES pH 7,25 для стабилизации pH и 0,2 мМ 1-фенил-2-тиомочевины. Дехорионирование не требовалось, ауксин эффективно проникал в хорион. Эмбрионы выдерживали в инкубаторе при 28,5 °С до 22 часов после оплодотворения, после чего их дехорионировали и фиксировали. Проведение эксперимента при 32 °C не привело к увеличению эффективности деградации. Самая низкая концентрация ауксина для эффективной деградации составляла 100 мкМ.

Иммуноокрашивание

Для анализа локализации ANAPC4 клетки, выращенные на покровных стеклах, фиксировали в течение 5 минут в 4% параформальдегиде (PFA), пермеабилизировали в течение 5 минут в буфере 1dx (0.1 % Triton X-100, 0,02 % додецилсульфат натрия (SDS) в PBS, блокировали в течение 1 ч 2 % BSA в PBS и инкубировали с антителами ANAPC4 (кроличьи поликлональные антитела, 1:1000, Beethyl Laboratories, A301– 176A) или анти-Flag M2 (мышиное моноклональное антитело, 1:10000, Sigma-Aldrich, F3165) в течение 1 ч при комнатной температуре. После обширной промывки PBS-T (0,1% Tween-20 в PBS) вторичные антитела (козьи антикроличьи Alexa 488, 1:500, Thermo Fisher Scientific, A-11008 или козьи антимышиные Alexa 594, Thermo Fisher Scientific , A11005) наносили на 1 ч в 2% BSA/PBS-T с последующей обширной промывкой PBS-T, постфиксацией 4% PFA в течение 5 мин и заливкой покровных стекол в VECTASHIELD (VECTOR Laboratories, H-1000 ).

Эмбрионы фиксировали в 4% PFA в PBS в течение 4 часов при комнатной температуре. Фиксированные эмбрионы блокировали в течение ночи при 4°C в блокирующем растворе (10% козья сыворотка, Thermo Fisher Scientific, 16210064, 1% BSA, 0,2% Triton X-100, разведенный в PBS). Затем образцы инкубировали в блокирующем растворе с 10 мкМ DRAQ5 (Thermo Fisher Scientific, 62251) в течение 3 дней при встряхивании при 4°C. Перед визуализацией образцы тщательно промывали в PBS + 0,2% Tween-20.

Получение изображения

Живые клетки HeLa и RPE-1 (hTERT) визуализировали с помощью широкопольного скринингового микроскопа ImageXpress Micro XLS (Molecular Devices), оснащенного 20 × /0.7, воздушный объектив (Nikon) и лазерный автофокус. В ходе эксперимента клетки содержались в стационарном инкубаторе при 37 °C во влажной атмосфере с 5% CO 2 . Все клеточные линии выращивали в 96-луночных планшетах с пластиковым дном (µclear, Greiner Bio-One). Визуализацию живых клеток проводили в модифицированной среде DMEM, содержащей 10 % (об. /об.) FBS, 1 % (об./об.) пенициллин-стрептомицин, 1 % (об./об.) глутамакса и 0,5 мкг/мл амфотерицина В без фенолового красного. и рибофлавин для уменьшения аутофлуоресценции 43 .Для мечения ядер зонд SiR-Hoechst (спирохром) для мечения флуорогенной ДНК живых клеток добавляли в конечной концентрации 100 нМ в среду для культивирования клеток за 2 часа до визуализации. Изображения клеток получали во время экспериментов по деградации каждые 5–10 минут или для экспериментов по восстановлению каждые 20 минут с использованием светового двигателя Spectra X (Lumencor) и камеры sCMOS (Andor) с биннингом   =   2 или 3 и фильтрами для YFP. Cy5 и Техасский красный. Иммуноокрашивание ANAPC4 получали с использованием флуоресцентного микроскопа с деконволюцией Deltavision Core Widefield (Applied Precision Inc.), оснащенный масляными иммерсионными объективами Olympus UPlanSApo 100×/1,4 или 60×/1,2, камерой CoolSNAPHQ2/HQ2-ICX285 и двигателем светодиодного освещения (Lumencor).

Визуализация фиксированных эмбрионов рыбок данио выполнялась в лазерном сканирующем конфокальном микроскопе LSM 780 (ZEISS) с использованием иммерсионного объектива LD C-Apochrom 40 × /1,1 (ZEISS). Эмбрионы помещали на чашки со стеклянным дном (MatTek Corporation) в 1% агарозу, разведенную в среде Е3. Стек z 30–40 мкм был получен с шагом 0,56 или 1 мкм при комнатной температуре.Покадровую визуализацию эмбрионов выполняли на конфокальной установке с вращающимся диском, состоящей из микроскопа IX71 (Olympus), сканирующей головки CSU-X1 (Yokogawa Electric Corporation), объектива UPLSAPO 60×/1,3 из силиконового масла (Olympus) и камеры Neo sCMOS ( Andor Technology), управляемая программным обеспечением iQ 3.0 (Andor Technology). Образцы помещали в 0,9% агарозу в среде E3, содержащей 0,1 М Hepes, pH 7,25 и 0,01% MS-222 (Sigma-Aldrich). Чашку заполняли средой E3, содержащей 0,01% MS-222 и 0,2 мМ N -фенилтиомочевины, и поддерживали при 28.5 °С. Чтобы уменьшить потенциальную фототоксичность, каждые 20 минут в течение 4 часов снимали только стопку 20 мкм с шагом 2 мкм при времени экспозиции 800 мс, биннинге = 2 и низкой мощности лазера ниже 5% от 75 мВт.

Количественная оценка флуоресценции GFP/Venus

Интенсивности Venus, Venus-ANAPC4 и AID-Venus-ANAPC4 были извлечены с использованием настроенного конвейера анализа изображений в MetaXpress (Molecular Devices). Вкратце, полученные изображения были сначала скорректированы по плоскому полю, подвергнуты цилиндрической фильтрации и сегментированы на основе ядер, окрашенных SiR-Hoechst (спирохром).Интенсивности от ядерных и цитоплазматических масок были скорректированы по фону и нормализованы к интенсивности в начале эксперимента. Количественную оценку Venus-LMNA, CCND1-Venus и INCENP-GFP выполняли вручную на изображениях с коррекцией плоского поля и фона с использованием Fiji 44 . В случае INCENP-GFP 11 из 70 mCherry-положительных клеток не показали деградации и не были включены в расчет средних кривых деградации.

Для презентации все изображения были скорректированы по фону с помощью Фиджи с радиусом катящегося шара 75 пикселей.На рис. 4e изображения были сглажены, и Фиджи заменил каждый пиксель средним значением его окрестности 3 × 3. Кроме того, интенсивность окрашивания ДНК SiR-Hoechst была индивидуально скорректирована для различных моментов времени на фиг. 3, 4 и дополнительные рисунки 5 и 6, поскольку интенсивность окрашивания SiR-Hoechst изменяется с течением времени. Количественная оценка изображений рыбок данио была выполнена на Фиджи. Стопку подвергали отбеливанию (простое соотношение), а затем измеряли среднюю интенсивность флуоресценции GFP-PCNA в 3.Область интереса размером 3 × 3,3 мкм с использованием менеджера области интереса в срезе z, содержащем центральную часть ядра. Для GFP-LAP2b вдоль области высокой интенсивности на ядерной оболочке была проведена линия толщиной 4 мкм, и было измерено среднее значение флуоресценции. Вычитали среднюю фоновую флуоресценцию и рассчитывали отношение флуоресценции в клетке, экспрессирующей систему деградации, к соседней контрольной клетке. Значение 1 означает отсутствие деградации, а значение 0 — полную деградацию.

Статистические методы

Призма 6.0 (Graphpad) использовался для статистики и создания графиков. Если не указано иное, все данные представлены как среднее  ± s.d. из указанного количества фильмов. Двусторонний критерий Манна-Уитни U был проведен для проверки значимости различий в распределении.

Добавить комментарий

Ваш адрес email не будет опубликован.